PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF111700140CFD_t1
Common NameTRAES_3BF111700140CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family WRKY
Protein Properties Length: 200aa    MW: 21083.4 Da    PI: 7.9802
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF111700140CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY96.22.2e-30115173159
                              ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                     WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                              ldDgy+WrKYG+K+vk+s++pr+YYrC+++gC+vkk+ver+++d ++v+++Yeg Hnh 
  TRAES3BF111700140CFD_t1 115 LDDGYKWRKYGKKSVKNSPNPRNYYRCSTEGCSVKKRVERDKDDANYVVTMYEGVHNHA 173
                              59********************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.2E-32103175IPR003657WRKY domain
SuperFamilySSF1182902.35E-27107175IPR003657WRKY domain
PROSITE profilePS5081130.607110175IPR003657WRKY domain
SMARTSM007749.6E-34115174IPR003657WRKY domain
PfamPF031068.2E-24116172IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MAVAGAGAAY RFHPHGAGSM AFPRPPGSGC PYSSGAPLSS PAFGGATGPG VLQQQLDVLD  60
YLSDDGGVPG TVGAPLPVEA AVVPDVGYCD HTSRAAAVAA SGKIAFRTRS EEEILDDGYK  120
WRKYGKKSVK NSPNPRNYYR CSTEGCSVKK RVERDKDDAN YVVTMYEGVH NHASPGTVYY  180
ASQDPASGRF FVTGTHHLAP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A4e-24100175277Probable WRKY transcription factor 4
1wj2_A4e-24100175277Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8404171e-160DQ840417.1 Hordeum vulgare subsp. vulgare WRKY transcription factor 18 (WRKY18) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003569675.11e-70PREDICTED: WRKY transcription factor 6-like
TrEMBLA0A077RU781e-146A0A077RU78_WHEAT; Uncharacterized protein
STRINGBRADI2G48090.14e-70(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44137206
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64810.12e-40WRKY DNA-binding protein 51
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]